The Hydro Park. Kharkiv Painting by Leonid Fedorov
The Hydro Park. Kharkiv Painting by Leonid Fedorov
The Hydro Park. Kharkiv – buy
The Hydro Park. Kharkiv – painting
Favoriteschevron_bottomSave
1

Characteristics of the Painting “The Hydro Park. Kharkiv”

Year of creation2019
Dimensions70 W × 50 H × 2 D   cm
Type of artpainting
Stylerealism
Genrecityscapes
Materialsoil, canvas
Keywords
roadhydroparkkharkivoilcanvaslandscapeautumnbirchmaplebirchmapleleavesheavyleaveslifeUkraine

Description of the Artwork “The Hydro Park. Kharkiv”

Automatic translation

“Hydropark. Kharkiv. "There is a beautiful autumn motif. Autumn trail in the Hydropark in the favorite city of Kharkiv.

The Hydro Park. Kharkiv

Original artwork, 70×50 cm, 2019
$570USD
Original artwork with a certificate of authenticity
Secure payment methods: card, bank
Free and easy 14 days returns
Find Similar Artworks
Shipping & returns
  • We offer expert global shipping, overseen by our logistics team.
  • We provide a 14-day return policy at no cost, excluding custom-made items.
Payment
About the artist

A bright representative of modern artists of peredvizhniki. Creates in the style of classic, realistic painting. He was born January, 2, 1948 year in the Kharkiv region. He graduated from The Kharkov Art School named after Illya Repin, The Kharkiv Art College, Kharkov Art and Industrial Institute (now Kharkiv State Academy of Design and Arts). 1971-1978 years - worked as the head of the Bureau of aesthetics of the Industrial Institute. 1978-1988 years - worked at the Kharkiv Art integrated works; 1989-1992 years - designed interiors and engaged in monumental works in an art cooperative; 1993-1995 years - was a teacher at the school; 1995-1998 years - designed Churches (painting and design) in Dnipropetrovsk region; 1999-2003 years - he was a head of the creative association of artists "Dnepropetrovsk Vernissage"; Since 2002 he has lived in the city of Zhovti Vody. Holds regular exhibitions of paintings (Kyiv, Dnipro, Vilnogorsk, Kryvyi Rih, Lubny, Zhovti Vody). In 2011 he started and headed the "Zhovtovodsk Vernissage". From 2018 till now he exhibits paintings at all-Ukrainian and international exhibitions.

Recently Viewed - 0 Artworks
Recommendations