Enjoy a first-purchase discount!
15% OFF ALL ARTWORKS
Fine Art Animal Drawing Ducks are flying by illustrator Lana Korolievskaia drawing ink cardboard
Ducks are flying Painting by Lana Korolievskaia
Ducks are flying – buy
Ducks are flying – drawing
Ducks are flying – order
Ducks are flying – buy online
Ask for more images
Favoriteschevron_bottomSave
20
1

Ducks are flying

Original drawing, 51×73 cm, 2025
$2,403USD
Shipping and taxes included
Need help?
Original artwork with a certificate of authenticity
Secured payment
PayPalVisaMastercardGoogle PayApple PayAmexWeChat PayAlipay
Free and easy 14 days returns
Expert global delivery, all costs included
Find Similar Artworks

Characteristics of the Drawing “Ducks are flying”

Year of creation2025
Dimensions51 W × 73 H × 0.3 D   cm
Type of artdrawing
Stylefine art
Genreanimal
Materialsdrawing ink, cardboard
Type of packagingcardboard box
Keywords
animalbirdsblackblackandwhitedrawingdrawingdrawingducksflightgraphicsgrayscaleinklamdscapenaturerepresentationsketchtreeswildwildlife

Description of the Artwork “Ducks are flying”

This work is a philosophical allegory of return and renewal. In the foreground, a dense forest stretches upward — its vertical lines filled with tension, as if the trees themselves are weary from standing guard over unfulfilled hopes. From behind the trees, a flock of birds emerges — not merely in motion, but as living thoughts gaining form. Their ascent is steady, directed toward a pale, awakening sky. This is not an impulse, but a quiet resolve. The landscape captures a transitional moment — between winter and spring, stillness and emergence. A cold band of water glimmers in the distance, symbolizing truth not yet spoken, but already known. This is a work about inner readiness — the moment before forgiveness, before spring, when silence finally reveals what matters most.

Artwork in the interior

interior
interior
interior
interior
About the artist

Was born on 18.01.1963 in the of town Berezniki, Perm region. Spent her childhood and youth at Cuban’. From 1980 till 1985 studied at Kharkov Art and Industrial Design Institute (now – Kharkov State Academy of Design and Arts) and finished the industrial art faculty (industrial Design department) with the distinction (diploma ЖВ-1 № 120406). 1987 – won the second prize in the Republic posters’ competition (Moldova, Kishinev). 1988 – won the first prize in the competition «The best project of Tiraspol’s dramatic theatre restoration (founded in 1925)». 1988-1990 г. – created the «KVINT» brand for the Tiraspol vine-cognac factory; visual identity for Tiraspol autorefregerator factory «TIZAR», NPO «TINJER», Moldavian softball team «VICTORY», Moldovian autotransporting enterprise «VENIT» etc. Since 1990 – the USSR Designers’ Union member (graphics section). Since 1991 – the Designers’ Union of Ukraine member (graphic section). 1991-1992 – created Dnepropetrovsk enterprises visual identity: television studio (TSD 34 canal), «Tehbi», «Torgmash», «Sintex», «Suzir’ya» «RIGEL», «Magnezit». 1992-1996 – the work for private collectors of England, Belgium, France, Canada (paintings, varnished miniatures). Since 1998 – the international Council for Books for Young people in Ukraine (UAiBbY) section member. 1998 – became the «Sicheslavna» (the highest theatrical award of Pridneprov’e) laureate in the «Dramatic art propaganda» nomination. 1999 – participated in the Book illustration exhibition in VVC (VDNKH, Moscow, Russia) taking place at the Book International fair. 1999 – participated in the International Exhibition of Professional Illustrators «17-th Biennale ВIВ-1999», Bratislava, Slovakia. 1999 г. – became the laureate of the First International Competition, devoted to A.S. Pushkin 200-th anniversary (Moscow, Russia). 2000 – participated in the International Exhibition of Professional Illustrators «Sixty best artists-illustrators of the world BIB-2000» (Tokyo, Japan). 2000 – participated in the illustrators exhibition «Futura-2000», Paris, France. 2001 – participated in the illustrators exhibition «Golden feather», Yugoslavia. 2001 – participated in the International Exhibition of Professional illustrators «18-th Biennale ВIВ-2001», town Bratislava, Slovakia. 2002 – participated in illustrator’s exhibition «Futura-2002», Paris, France. 2002 – participated in illustrator’s exhibition «Bologna Children’s Book Fair». Bologna, Italy. 2002 – stagegraphy to spectacle «Little elephant», puppet theatre, Dnepropetrovsk. 2003 – participated in international exhibition of professional illustrators «19-th Biennale ВIВ-2003», town Bratislava, Slovakia. 2003 – created stage scenery for the dramatic performance after T. Klebanskaya «Who will go to Canada?»,Youth theatre, Dnepropetrovsk. 2004 – was awarded by iBbY (International Council for Books for Young people) Honour List 2004 for the high quality illustrations, Basel, Switzerland and by the Certificate of Honour for Illustration (for “Piratic stories”), Cape Town, South Africa. 2004 – participated in ІІ Competition named after G. Yakutovich, the National Artists’ Union of Ukraine, Kyiv. 2005 – participated in II Bienal internacional de ilustracao para a infancia 2005, Lisboa, Portugal. 2007 – participated in III Bienal internacional de ilustracao para a infancia 2007, Lisboa, Portugal. 2007 – won the first prize on DESIGN FESTIVAL COW/07/«Illustration», Dnepropetrovsk, Ukraine. 2008 – participated in the Spring international photo competition «The Al-Thani award», Special themes circuit 2008, Linz, Austria. 2008 – participated in the Autumn international photo competition «The Al-Thani award», Special themes circuit 2008, Linz, Austria. 2009 – participated in IV Bienal internacional de ilustracao para a infancia 2009, Portugal. 2010 – participated in the Spring international photo competition «The Al-Thani award», Special themes circuit 2010, Linz, Austria. Since 1994 until now teaches in Dnepropetrovsk Theatrical-artistic College (former Dnepropetrovsk State School of Arts named after E. Vuchetich) 2011 – spring international photo contest The Al-Thani award, Special themes circuit 2011, Linz, Austria. 2011 – V Bienal internacional de ilustracao para a infancia 2011, Portugal. 2013 – VI Bienal internacional de ilustracao para a infancia 2013, Portugal. From 1994 to the present time he teaches at the Dnepropetrovsk theatrical and artistic college (the former Dnipropetrovsk State Art School named after E. Vuchetich). Dean of the Faculty of Design. 2024 – Dnipro art museum. Joint exhibition «Labyrinths of creativity» with Volodymyr Korolievskyi, Dnipro, Ukraine. 2024 – All-Ukrainian exhibition of pastels «Attractive world of pastels», Dnipro, Ukraine. Author’s bibliography You can become acquainted with creative work of modern artist Lana Korolіevskaіa. This exposition presents book illustrations she created during 1990-2007: 1. V.P. Polikarpov, L.G. Polikarpova, E.G. Goncharenko. «Orchard and kitchen-garden. Useful advices» Kishinyov. «Timpul» 1990. ISBN 5-7790-0045-X 2. James Barry, Clive Lewis, Maria Kruger. «Blue bead. Magic tales». Dnepropetrovsk, «Rayduga», 1994. ISBN 5-7707-3756-5 3. Russian folk tale. «Teremok». Dnepropetrovsk, «Continent», 1996. ISBN 5-775-0636-4 4. V. Korolievskyi. « Where does rainbow live?». Dnepropetrovsk, «Dana», 1998. ISBN 966-95247-7-6 5. Ukrainian folk counting-out rhymes. «Hare the King». Dnepropetrovsk, «Dana», 1998. ISBN 966-95247-6-8 6. V. Korolievskyi. «Cat’s song». Dnepropetrovsk, «Dana», 1998. ISBN 966-95247-1-7 7. After the motif of Russian folk tale. «Fox with a rolling-pin». Dnepropetrovsk, «Dana», 1998. ISBN 966-95247-2-5 8. V. Korolievskyi. «How frog learned to jump». Dnepropetrovsk, «Dana», 1998. ISBN 966-95247-3-3 9. After the motif of Charle Perro’ tale. «Red Cap». Dnepropetrovsk, «Dana», 1998. ISBN 966-95247-0-9 10. Kovalenko L. «Wizard». Dnepropetrovsk, «Dnieprokniga», 1998. ISBN 5-89975-098-7 11. O. Pchilka «For children». Dnepropetrovsk, «Dnieprokniga», 1998. ISBN 5-89975-098-7 12. Olexandr Zobenko. «Poplar pain». Dnepropetrovsk, «Dnieprokniga», 1998. ISBN 5-89975-112-6 13. Nadiya Lebid’. «My Ukraine». Dnepropetrovsk, «Dnieprokniga», 1999. ISBN 5-89975-110-х 14. «Paint and count». Dnepropetrovsk, «Dana», 1999. ISBN 966-7410-03-х 15. L. Korolievskaia. «Geoleo». Dnepropetrovsk, «Dnieprokniga», 1999. ISBN 5-899750-098-098-7 16. «My favorite colours». Dnepropetrovsk, «Dana», 1999. ISBN 966-7410-01-3 17. Lucine Arakelyan, Volodya Korolievskyi. «Town of dreams». Dnepropetrovsk, «Dreprkniga», 2000. ISBN 966-7691-08-х 18. Collection of the Ukrainian and Russian literature works for reading in the 1st class. «Prominchick 1». Dnepropetrovsk, «Dnieprokniga», 2000. ISBN 966-7691-11-х 19. Collection of the Ukrainian and Russian literature works for reading in 2nd class. «Prolisok 2». Dnepropetrovsk, «Dnieprokniga», 2000. ISBN 966-7691-12-8 20. Collection of the Ukrainian and Russian literature works for reading in the 3rd class. «Strumok 3». Dnepropetrovsk, «Dnieprokniga», 2000. ISBN 966-7691-13-6 21. Tatyana Klebanskaya. «Palack, the Tsar of the Scythians». Dnepropetrovsk, «Dnieprokniga», 2001. ISBN 966-7691-21-1 22. Tatyana Klebanskaya. «Scythian sword in gods’ hands». Dnepropetrovsk, «Dnieprokniga», 2001. ISBN 966-7691-27-6 23. Timur Kobzar. «Whale-child from the Lake country». Dnepropetrovsk, «Dnieprokniga», 2001. ISBN 966-7691-19-5 24. Tatyana Klebanskaya. «Piratic stories». Dnepropetrovsk, «Prospect», 2002. ISBN 966-95899-4-0 (Honour list 2004) 25. Jury Ligun. «Popelushko the King». Dnepropetrovsk, «Prospect», 2002. ISBN 966-95899-2-4 26. Jury Ligun. «Iron Boulkin». Dnepropetrovsk, «Prospect», 2003. ISBN 966-95899-2-5 27. Under common editorship of T. Shpakovskaya. Encyclopedia. «Theatres of Dnepropetrovsk region». Dnepropetrovsk, «Dnieprokniga», 2003. ISBN 966-7691-50-0 28. Tatyana Klebanskaya. «Fate’s flow carries me…». Dnepropetrovsk, «Dnieprokniga», 2004. ISBN 966-7691-57-8 29. Alexandra Kravchenko. «Anna. Rapids of love and Dnepr». Dnepropetrovsk, «Dnieprokniga», 2004. ISBN 966-7691-61-6 30. Alexandra Kravchenko. «Maria. Rapids of love and Dnepr». Dnepropetrovsk, «Dnieprokniga», 2004. ISBN 966-4691-62-4 31. M.S. Bogomaz. «Pridneprov’e moves and flows…». Dnepropetrovsk, «Dnieprokniga», 2004. ISBN 966-7691-67-5 32. Ganna Spepit’ko. «On the borders of symbols». Dnepropetrovsk, «Dnieprokniga», 2005. ISBN 966-7691-77-2 33. Ratner A.G. «All inside out». Dnepropetrovsk, «Prospect», 2005 ISBN 966-8345-08-8 (Honour list 2006) 34. «From the whole soul» Collection of poetry. Dnepropetrovsk, «Dnieprokniga», 2006. ISBN 966-401-023-5 35. Tatyana Shpakovskaya. «Dnepropetrovsk’s Philharmonic». Dnepropetrovsk, «Dnieprokniga», 2006. ISBN 966-401-022-7 36. Alexandra Kravchenko. «The Dnepr Amazones. Legends». Dnepropetrovsk. «Dnieprokniga», 2006. ISBN 966-401-004-9 (Honour list 2008) 37. Bugayova E.V. «Etiquette for everyday use». Manual. Dnepropetrovsk. «Dnieprokniga», 2007. ISBN 978-966-401-028-0 38. О. Paliy. «Cocktail». Dnepropetrovsk, «Dnieprokniga», 2008. ISBN 978-966-401-128-8 39. Training manual "Anatomy", posters, Dnepropetrovsk, "Dneprkniga", 2009. 40. Training manual "Botanica", posters, Dnepropetrovsk, "Dniprniga", 2009. 41. Training manual "Zoology", posters, Dnepropetrovsk, "Dniprniga", 2009. 42. Lucine Arakelyan-Mnatskanyan. Wise tales. Dnepropetrovsk, "Thresholds", 2011. ISBN 978-617-518-170-6 43. Valentina Losebnik. "Unknown Ekaterinoslav". Дніпропетровськ, Дніпрокнига, 2012. ISBN 978-966-401-060-0 44. O.Vilkul "The paternal hero in the people is not dying, who was in the diaspora of the Dnipro ...". Dnipropetrovsk, DniproKniga, 2013. ISBN 978-966-401-051-8 45. Lana Korolievskaia and Vladimir Korolievskyi. "Letinarh". Dnepropetrovsk, Dniprokniga, 2014. ISBN 978-966-401-061-7 46. Lana Korolievskaia "Petrikovskaya chepurushka." Dnepropetrovsk, "Dneprkniga", 2017. ISBN 978-966-401-062-4

Recently Viewed - 0 Artworks
Recommendations